General Information

  • ID:  hor000094
  • Uniprot ID:  O42493??20-28)
  • Protein name:  Isotocin
  • Gene name:  NA
  • Organism:  Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Takifugu (genus), Tetraodontidae (family), Tetradontoidea (superfamily), Tetraodontoidei (suborder), Tetraodontiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CYISNCPIG
  • Length:  9(20-28)
  • Propeptide:  MTGTAISVCLLFLLSVCSACYISNCPIGGKRSIMDAPQRKCMSCGPGDRGRCFGPGICCGESFGCLMGSPESARCAEENYLLTPCQAGGRPCGSEGGLCASSGLCCDAESCTMDQSCLSEEEGDERGSLFDGSDSGDVILKLLRLAGLTSPHQTH
  • Signal peptide:  MTGTAISVCLLFLLSVCSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause contraction of smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-Q9R171-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9R171-F1.pdbhor000094_AF2.pdbhor000094_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 111202 Formula: C41H64N10O13S2
Absent amino acids: ADEFHKLMQRTVW Common amino acids: CI
pI: 5.81 Basic residues: 0
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: 71.11 Boman Index: 316
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 2708.89 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  8714027
  • Title:  Structure and Organization of the Isotocin and Vasotocin Genes From Teleosts